Sinh học - Chapter 4: Part 2 protein 3-D structure: 3o and 4o structure and protein folding

Stabilize native structure Formed after native conformation achieved Abundant in secreted proteins but not in intracellular proteins Protein disulfide isomerase catalyzes reduction of incorrect disulfide linkages

ppt16 trang | Chia sẻ: nguyenlam99 | Lượt xem: 1221 | Lượt tải: 1Freedownload
Bạn đang xem nội dung tài liệu Sinh học - Chapter 4: Part 2 protein 3-D structure: 3o and 4o structure and protein folding, để tải tài liệu về máy bạn click vào nút DOWNLOAD ở trên
Chapter 4: Part 2Protein 3-D structure: 3o and 4o structure and protein folding. 3o Structurethird level of protein organizationfolding of polypeptide chain causes 2o structures to interactformation of motifs and domainsProteins with similar 1o structure also have similar 3o structuretuna 1 GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWN yeast 1 GSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVWDE rice 1 GNPKAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTPGYSYSTANKMAVIWEE tuna 61 ETLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS yeast 61 NNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKACE rice 61 NTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLISYLKEATS Common MotifsMotifs Combine to form DomainsHydrophobic interactions are the major driving force in folding domainsAlpha/beta barrelParallel twisted sheetDomains are independent folding units in a 3o structure of a proteinIndividual domains have specific functionlactate dehydrogenasemalate dehydrogenaseCOO-CH2COCOO-COO-CHHOCH2COO-3COO-CHCHHOCOO-CCH3O+ NADH+ NAD++ NADH+ NAD+Protein family members share common domain structures4o StructureQuaternary structure describes the organization of subunits in a protein with multiple subunits (oligomeric protein)Can have homo-multimers or hetero-multimersa2b2a2bgDetermine molecular weight of native protein by gel permeation chromatographyDetermine molecular weight of individual subunits by SDS-PAGECan use the information to determine subunit composition4o StructureIf. Native protein – 160,000 daltons and a-Subunit – 50,000 daltons b-Subunit – 30,000 daltonsThenProtein can have a2b2 structureSubunits held together by non-covalent interactionsOligomeric protein is more stable than disassociated subunitsActive site often made up of AA residues from different subunits4o and 3o structure is often affected by ligand (substrate or inhibitor) binding. Important in enzyme regulation4o StructureTmProtein denaturationDenaturation – disruption of native conformationHeat commonly used to denature proteins Tm = temperature where 50% folded/50% unfolded.Typical Tm = 40-60oCTm for thermophiles >100oC (Taq DNA polymerase)Chemical denaturants Chaotrophic agents = Urea, KCN detergents = SDSProtein FoldingRibonuclease A (RNase A) will refold to native structure spontaneously (1 minute)>1050 possible conformationsIf 10-13 sec per conformation would take 1030 years to sample enough to determine structureHow do proteins fold so quickly?Factors driving protein foldingConformational entropy A+B  C decreases entropy (unfavorable)Non-covalent interactions give favorable enthalpy valueHydrophobic effect increases entropy by freeing water (favorable)DG = DH - TDS-+Protein FoldingStructures of globular proteins are not static Proteins “breathing” between different conformationsProteins fold towards lowest energy conformationMultiple paths to lowest energy formAll folding paths funnel towards lowest energy formLocal low energy minimum can slow progress towards lowest energy formPathway of Protein Folding1) Nucleation of folding - Rapid and reversible formation of local 2o structures form 2) Formation of domains (Molten Globular intermediates) through aggregation of local 2o structures 3) Domain conformations adjust to form native proteinChaperonins Protein complexes that promote protein foldingChaperonins don’t determine native structurePrevent misfolding and aggregation of proteinSequesters unfolded protein from other proteinsRequire ATP for protein binding, after ATP hydrolysis native protein releasedThought to bind unfolded regions of protein Disulfides BondsStabilize native structureFormed after native conformation achievedAbundant in secreted proteins but not in intracellular proteinsProtein disulfide isomerase catalyzes reduction of incorrect disulfide linkages

Các file đính kèm theo tài liệu này:

  • pptchapter_4_part_2_2089.ppt
Tài liệu liên quan